davidwool.com
visit the website
Advertisements
1,533,147
United States
11,998,248
World Rank
Domain | http://www.davidwool.com |
Daily visits | 28 |
Daily pages views | 100 |
Estimated value | £420 * |
Income per visitor | £2.25 |
Incoming links | 9 |
Keyphrases |
---|
drunk, driving, felonies, lawyers, attorneys |
Rank in Countries |
---|
Web Traffic
Statistics History 3 Months Average | ||
---|---|---|
World Rank | 11,998,248 | -68,390 |
Monthly Visitors | 780 | 0.57% |
Monthly Visitors Rank | 11,831,627 | -67,440 |
Monthly Pageviews | 3,000 | -4% |
Monthly Pageviews Rank | 18,328,615 | +733,145 |
Pageviews Per Visitor | 3.83 | - |
Context
Headlines for www.davidwool.com | |
---|---|
The domain has been registered 24 years 9 months 27 days ago. |
Related Websites
colemaneconomics.com collectionlaw-firm.com colorado-elder-probate-lawyer.com condemnationeminentdomainlaw.com cooperlawfirm.com criminalattorneyfornewyork.com criminaldefenselawyerlasvegas.com criticalcareexpert.com deepoceandrilling.comWeb Server
Data Center Information | |
---|---|
AS19994 Rackspace Hosting Chicago Illinois United States 41.85, -87.65 |
|
Web server load time is 0.63 seconds. |
Its nameservers are ns1.lawinfo.com (23.253.239.143), ns2.lawinfo.com (23.253.239.143). Its IP number is 23.253.33.58 | |
IP: | 23.253.33.58 |
Server type: | Apache/2.2.15 (CentOS) |
Charset: | ISO-8859-1 |
PING www.davidwool.com (23.253.33.58) The package size is 53 bytes. | |
---|---|
53 bytes for 23.253.33.58: seq_num=1 TTL=73 | 38.5 ms |
53 bytes for 23.253.33.58: seq_num=2 TTL=73 | 38.2 ms |
53 bytes for 23.253.33.58: seq_num=3 TTL=73 | 38.8 ms |
--- www.davidwool.com ping results --- | |
4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
An average ping to the server is 28.9 ms, and the page load time is 0.63 seconds. |
Web Server Configuration | |
---|---|
Content Length: | 312 |
Content Type: | text/html; charset=iso-8859-1 |
Date: | Tue, 17 Mar 2015 13:08:19 GMT |
Web Server: | Apache/2.2.15 (CentOS) |
X Powered By: | PHP/5.4.36 |
Vary: | + |
P3P: | - |
Cookies: | - |
ETag: | - |
MD5 Content: | - |
Public Key Pins: | - |
The data is estimated*
Data modified: 25.03.2015 01:56:41
Advertisements