ridgewayandernest.com
visit the website
Advertisements
3,201,891
United States
18,581,543
World Rank
| Domain | http://www.ridgewayandernest.com |
| Daily visits | 16 |
| Daily pages views | 73 |
| Estimated value | £360 * |
| Income per visitor | £2.01 |
| Incoming links | 1 |
| Keyphrases |
|---|
| electrician, electricians, electrical contractors, insured, licensed, bonded, residential, commercial, washington |
| Rank in Countries |
|---|
Web Traffic
| Statistics History 3 Months Average | ||
|---|---|---|
| World Rank | 18,581,543 | -427,375
 |
| Monthly Visitors | 480 | 2.3%
|
| Monthly Visitors Rank | 20,064,939 | -461,494
|
| Monthly Pageviews | 2,190 | -0%
 |
| Monthly Pageviews Rank | 18,580,367 |
+0
|
| Pageviews Per Visitor | 4.55 | - |
Context
| Headlines for www.ridgewayandernest.com | |
|---|---|
| The domain has been registered 22 years 1 months 27 days ago. | |
Related Websites
1hourchimney.com acsconcept.com adeptusa.com adorableakk.com advancedmotortech.com aerocorporation.com agenciaholandesa.com ahavta.org allindiatravelinfo.comLinks
| Outgoing Links | |
|---|---|
| apollosunergy.com | |
| ApolloSunErgy.com | |
| iec-chesapeake.com | |
| ridgewayandernest.servicemagicpro.com | |
| servicemagic.com | |
| apollosunergy.com | |
| 480 guests visit the website monthly, each of them views about 4.55 pages. | |
Web Server
| Data Center Information | |
|---|---|
|
Network Solutions, LLC AS19871 Network Solutions, LLC Jacksonville Florida United States 30.1376, -81.5428 |
|
| Web server load time is 0.70 seconds. | |
| Its nameservers are ns1.dnsbycomodo.net (8.20.241.1), ns2.dnsbycomodo.net (8.20.243.1). Its IP number is 205.178.152.157 | |
| IP: | 205.178.152.157 |
| Server type: | Microsoft-IIS/8.5 |
| Charset: | LATIN1 |
| PING www.ridgewayandernest.com (205.178.152.157) The package size is 33 bytes. | |
|---|---|
| 33 bytes for 205.178.152.157: seq_num=1 TTL=56 | 26.8 ms |
| 33 bytes for 205.178.152.157: seq_num=2 TTL=56 | 28.3 ms |
| 33 bytes for 205.178.152.157: seq_num=3 TTL=56 | 26.7 ms |
| --- www.ridgewayandernest.com ping results --- | |
| 4 queries proceeded, 4 packets received, 0 lost (0% loss) | |
| An average ping to the server is 20.5 ms, and the page load time is 0.70 seconds. | |
| Web Server Configuration | |
|---|---|
| Cache Control: | private |
| Content Length: | 13626 |
| Content Type: | text/html |
| Date: | Thu, 19 Mar 2015 23:50:24 GMT |
| Web Server: | Microsoft-IIS/8.5 |
| X Powered By: | ASP.NET |
| Cookies: | + |
| P3P: | - |
| Vary: | - |
| ETag: | - |
| MD5 Content: | - |
| Public Key Pins: | - |
The data is estimated*
Data modified: 25.03.2015 02:29:21
Advertisements