www.superelitedubaiescorts.com - Super elite Dubai Escorts is an Escort Agency providing top elite girls in the UAE and the Middle Ea - Superelitedubaiescorts

superelitedubaiescorts.com

visit the website

Superelitedubaiescorts is #1,386,902 website in United Kingdom. "Super elite Dubai Escorts is an Escort Agency providing top elite girls in the UAE and the Middle Ea."

1,386,902

19,708,747

World Rank

Domain http://www.superelitedubaiescorts.com
Daily visits 19
Daily pages views 64
Estimated value £341 *
Income per visitor £2.48
Incoming links 0
Keyphrases
-
Rank in Countries
g+ twitter facebook

Web Traffic

Statistics History 3 Months Average
World Rank 19,708,747 +1,015,000
Monthly Visitors 480 -5.15%
Monthly Visitors Rank 50,915,525 +2,622,150
Monthly Pageviews 1,920 -0%
Monthly Pageviews Rank 50,915,525 +0
Pageviews Per Visitor 4.03 -

Context

Headlines for www.superelitedubaiescorts.com
The domain has been registered 10 years 3 months 16 days ago.

Related Websites

connexionweb.co.uk   orientalmassagelondon.co.uk   007escorts.co.uk   absolutelondonescorts.co.uk   agencybarracuda.co.uk   awakeningtantricenergyspamassage.com   blog4asianescorts.co.uk   blog4escorts.co.uk   bluecoutureclub.com   

Web Server

Data Center Information

AS62240 Clouvider Limited
London
England
United Kingdom
51.5085, -0.1257
Web server load time is 0.52 seconds.
Its nameservers are ns1.lucid.dnsonly.co.uk (185.42.221.40), ns2.lucid.dnsonly.co.uk (185.42.221.41). Its IP number is 185.42.221.40
IP: 185.42.221.40
Server type: Apache
Charset: UTF-8
PING www.superelitedubaiescorts.com (185.42.221.40) The package size is 28 bytes.
28 bytes for 185.42.221.40: seq_num=1 TTL=54 50.7 ms
28 bytes for 185.42.221.40: seq_num=2 TTL=54 52.4 ms
28 bytes for 185.42.221.40: seq_num=3 TTL=54 50.7 ms
--- www.superelitedubaiescorts.com ping results ---
4 queries proceeded, 4 packets received, 0 lost (0% loss)
An average ping to the server is 38.5 ms, and the page load time is 0.52 seconds.
Web Server Configuration
Cache Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Content Type: text/html; charset=UTF-8
Date: Sat, 01 Apr 2017 12:21:03 GMT
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Link: ; rel=shortlink
Pragma: no-cache
Web Server: Apache
Cookies: +
P3P: -
Vary: -
ETag: -
MD5 Content: -
Public Key Pins: -

The data is estimated*
Data modified: 28.09.2017 20:54:24